.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q6w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of monoamine oxidase regulatory protein from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 1q6w Target Id NYSGXRC-T805
    Molecular Characteristics
    Source Archaeoglobus fulgidus.
    Alias Ids TPS8138,O28346 Molecular Weight 18086.09 Da.
    Residues 161 Isoelectric Point 5.46
    Sequence mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgm lvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksgvvtyklev knqrgelvltalysalirktpsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.81 Rfree 0.276
    Matthews' coefficent 2.58 Rfactor 0.242
    Waters Solvent Content 50.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q6w
    1. Rv0216, a conserved hypothetical protein from Mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdog fold
    A Castell, P Johansson, T Unge, TA Jones - Protein , 2005 - Wiley Online Library
     
    2. Structure and function of Rv0130, a conserved hypothetical protein from Mycobacterium tuberculosis
    P Johansson, A Castell, TA Jones, K Bckbro - Protein science, 2006 - Wiley Online Library
     
    3. Rv3389C from Mycobacterium tuberculosis, a member of the ( R)-specific hydratase/dehydratase family
    E Sacco, V Legendre, F Laval, D Zerbib - et Biophysica Acta (BBA , 2007 - Elsevier
     
    4. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    5. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     
    6. Structural Studies of a Xyloglucan Endotransglycosylase from Populus tremula x tremuloides and Three Conserved Hypothetical Proteins from Mycobacterium
    P Johansson - 2006 - uu.diva-portal.org
     
    7. Fighting Tuberculosis
    A CASTELL - 2008 - uu.diva-portal.org
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch