.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Escherichia coli YfdW, a type III CoA transferase. Acta Crystallogr.,Sect.D 60 507-511 2004
    Site NYSGXRC
    PDB Id 1q6y Target Id NYSGXRC-T783
    Related PDB Ids 1q7e 1pqy 
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8129,P77407 Molecular Weight 45825.75 Da.
    Residues 416 Isoelectric Point 5.36
    Sequence mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyftmlnsnkrs ielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlifgsikgfdecspyvnvka yenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaallhrektgrgqrvtmsmqdavlnl crvklrdqqrldklgyleeypqypngtfgdavprggnaggggqpgwilkckgwetdpnayiyftiqeqn wentckaigkpewitdpaystaharqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeis ldpslrqsgsvveveqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.99 Rfree 0.2
    Matthews' coefficent 2.25 Rfactor 0.16
    Waters 276 Solvent Content 45.36

    Ligand Information
    Ligands COA (COENZYME) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 7
    Metals

    Jmol

     
    Google Scholar output for 1q6y
    1. Structure of Escherichia coli YfdW, a type III CoA transferase
    A Gogos, J Gorman, L Shapiro - Acta Crystallographica Section D: , 2004 - scripts.iucr.org
     
    2. Crystal structure of Escherichia coli crotonobetainyl-CoA: carnitine CoA-transferase (CaiB) and its complexes with CoA and carnitinyl-CoA
    ES Rangarajan, Y Li, P Iannuzzi, M Cygler, A Matte - Biochemistry, 2005 - ACS Publications
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Formyl_coenzyme A (CoA): Oxalate CoA_transferase from the acidophile Acetobacter aceti has a distinctive electrostatic surface and inherent acid stability
    EA Mullins, CM Starks, JA Francois, L Sael - Protein , 2012 - Wiley Online Library
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch