.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q98

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Thiol Peroxidase from Haemophilus influenzae Rd. To be Published
    Site NYSGXRC
    PDB Id 1q98 Target Id NYSGXRC-T1429
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8163,Q57549 Molecular Weight 17625.10 Da.
    Residues 165 Isoelectric Point 4.97
    Sequence mtvtlagnpievgghfpqvgeivenfilvgndladvalndfaskrkvlnifpsidtgvcatsvrkfnqq aaklsntivlcisadlpfaqarfcgaegienaktvstfrnhalhsqlgvdiqtgplagltsravivlde qnnvlhsqlveeikeepnyeaalavla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.267
    Matthews' coefficent 2.07 Rfactor 0.225
    Waters 275 Solvent Content 40.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q98
    1. High-throughput computational and experimental techniques in structural genomics
    MR Chance, A Fiser, A Sali, U Pieper, N Eswar - Genome , 2004 - gb.cw.com.tw
     
    2. Crystal structure of a novel Plasmodium falciparum 1-Cys peroxiredoxin
    GN Sarma, C Nickel, S Rahlfs, M Fischer - Journal of molecular , 2005 - Elsevier
     
    3. Structural survey of the peroxiredoxins
    PA Karplus, A Hall - Peroxiredoxin systems, 2007 - Springer
     
    4. Crystal structure and solution NMR dynamics of a D (type II) peroxiredoxin glutaredoxin and thioredoxin dependent: a new insight into the peroxiredoxin oligomerism
    A Echalier, X Trivelli, C Corbier, N Rouhier - Biochemistry, 2005 - ACS Publications
     
    5. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    6. The mycobacterial thioredoxin peroxidase can act as a one-cysteine peroxiredoxin
    M Trujillo, PL Mauri, L Benazzi, M Comini - Journal of Biological , 2006 - ASBMB
     
    7. Functional and Structural Characterization of a Thiol Peroxidase from Mycobacterium tuberculosis
    BS Rho, LW Hung, JM Holton, D Vigil, SI Kim - Journal of molecular , 2006 - Elsevier
     
    8. Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase
    M Stehr, HJ Hecht, T Jager, L Flohe - Section D: Biological , 2006 - scripts.iucr.org
     
    9. Proteinprotein interactions within peroxiredoxin systems
    V Noguera-Mazon, I Krimm, O Walker - Photosynthesis , 2006 - Springer
     
    10. Mitochondrial peroxiredoxins
    Z Cao, JG Lindsay, NW Isaacs - Peroxiredoxin Systems, 2007 - Springer
     
    11. Peroxiredoxin systems in mycobacteria
    T Jaeger - Peroxiredoxin Systems, 2007 - Springer
     
    12. Classification of peroxiredoxin subfamilies using regular expressions
    JK Chon_, J Choi_, S Soo - Genomics & Informatics, 2005 - genominfo.org
     
    13. Caracterizacin bioqumica y molecular de una peroxirredoxina mitocondrial de Pisum sativum
    SB MEDINA - 2006 - hera.ugr.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch