.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q9j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PapA5, a Phthiocerol Dimycocerosyl Transferase from Mycobacterium tuberculosis. J.Biol.Chem. 279 30634-30642 2004
    Site NYSGXRC
    PDB Id 1q9j Target Id NYSGXRC-T760
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS8122,P96208 Molecular Weight 45426.24 Da.
    Residues 422 Isoelectric Point 4.82
    Sequence mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqssdggwnlva ddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltlylhhcmadghhgavlvde lfsrytdavttgdpgpitpqptplsmeavlaqrgirkqglsgaerfmsvmyayeipatetpavlahpgl pqavpvtrlwlskqqtsdlmafgrehrlslnavvaaailltewqlrntphvpipyvypvdlrfvlappv apteatnllgaasylaeigpntdivdlasdivatlradlangviqqsglhfgtafegtppglpplvfct datsfptmrtppgleiedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvp seygwime
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.75 Rfree 0.295
    Matthews' coefficent 3.99 Rfactor 0.236
    Waters 226 Solvent Content 68.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q9j
    1. Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum KINETIC
    GS Garvey, SP McCormick, I Rayment - Journal of Biological Chemistry, 2008 - ASBMB
     
    2. The molecular architecture of major enzymes from ajmaline biosynthetic pathway
    J Stckigt, S Panjikar, M Ruppert, L Barleben - Phytochemistry , 2007 - Springer
     
    3. Structural genomics as an approach towards understanding the biology of tuberculosis
    EN Baker - Journal of structural and functional genomics, 2007 - Springer
     
    4. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     
    5. Structural basis for modification of flavonol and naphthol glucoconjugates by Nicotiana tabacum malonyltransferase (NtMaT1)
    BA Manjasetty, XH Yu, S Panjikar, G Taguchi - Planta, 2012 - Springer
     
    6. Structural and functional studies of Secondary Metabolite AcylTransferase superfamily members from the trichothecene mycotoxin biosynthetic pathway
    GS Garvey - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch