.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold. To be Published
    Site NYSGXRC
    PDB Id 1r3d Target Id NYSGXRC-T920
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8153,Q9KQM4 Molecular Weight 28968.40 Da.
    Residues 263 Isoelectric Point 6.36
    Sequence mlsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnperhcdnfaeave mieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqeneekaarwqhdqq waqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvahmllatslakqpyllpalqalk lpihyvcgeqdskfqqlaessglsysqvaqaghnvhheqpqafakivqamihsiid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.21554
    Matthews' coefficent 2.26 Rfactor 0.17932
    Waters 164 Solvent Content 45.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r3d
    1. Identification and Characterization of (1 R, 6 R)-2-Succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate Synthase in the Menaquinone Biosynthesis of Escherichia
    M Jiang, X Chen, ZF Guo, Y Cao, M Chen, Z Guo - Biochemistry, 2008 - ACS Publications
     
    2. Catalytic mechanism of SHCHC synthase in the menaquinone biosynthesis of Escherichia coli: identification and mutational analysis of the active site residues
    M Jiang, X Chen, XH Wu, M Chen, YD Wu, Z Guo - Biochemistry, 2009 - ACS Publications
     
    3. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    4. Identification of family-specific residue packing motifs and their use for structure-based protein function prediction: II. Case studies and applications
    D Bandyopadhyay, J Huan, J Prins, J Snoeyink - Journal of computer- , 2009 - Springer
     
    5. Exploiting the high-resolution crystal structure of Staphylococcus aureus MenH to gain insight into enzyme activity
    A Dawson, PK Fyfe, F Gillet, WN Hunter - BMC structural biology, 2011 - biomedcentral.com
     
    6. Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis
    JM Johnston, M Jiang, Z Guo - Section D: Biological , 2010 - scripts.iucr.org
     
    7. The unusual extended C-terminal helix of the peroxisomal [alpha]/[beta]-hydrolase Lpx1 is involved in dimer contacts but dispensable for dimerization
    S Thoms, J Hofhuis, C Thing, J Grtner - Journal of structural , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch