.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Ylba, hypothetical protein from E.Coli. To be Published
    Site NYSGXRC
    PDB Id 1rc6 Target Id NYSGXRC-T1521
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8186,16128499 Molecular Weight 30029.23 Da.
    Residues 273 Isoelectric Point 5.26
    Sequence mslgylnnvtgyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlh qnggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsqiflykrcy vpvegyapwlvsgnaselerihyegmddvilldflpkelgfdmnmhilsfapgashgyiethvqehgay ilsgqgvynldnnwipvkkgdyifmgayslqagygvgrgeafsyiyskdcnrdveieggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.267
    Matthews' coefficent 3.43 Rfactor 0.232
    Waters Solvent Content 62.72

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rc6
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Crystal structure of ureidoglycolate hydrolase (AllA) from Escherichia coli O157: H7
    S Raymond, A Tocilj, E Ajamian, Y Li - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. The crystal structure of 5_keto_4_deoxyuronate isomerase from Escherichia coli
    RL Crowther, MM Georgiadis - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    4. Structural and Functional Insights into (S)-Ureidoglycine Aminohydrolase, Key Enzyme of Purine Catabolism in Arabidopsis thaliana
    I Shin, R Percudani, S Rhee - Journal of Biological Chemistry, 2012 - ASBMB
     
    5. Klassifikationsverfahren zur systematischen Fremdschlsselbestimmung aus Inklusionsabhngigkeiten
    A Rostin - 2009 - informatik.hu-berlin.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch