.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rfx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Disulfide-dependent multimeric assembly of resistin family hormones. Science 304 1154-1158 2004
    Site NYSGXRC
    PDB Id 1rfx Target Id NYSGXRC-T127
    Related PDB Ids 1rgx 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8094,Q9HD89 Molecular Weight 12490.92 Da.
    Residues 114 Isoelectric Point 8.01
    Sequence mknlsfpllflfflvpellgssmplcpideaidkkikqdfnslfpnaikniglncwtvssrgklascpe gtavlscscgsacgswdireekvchcqcaridwtaarccklqvas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.21597
    Matthews' coefficent 2.73 Rfactor 0.17724
    Waters 205 Solvent Content 54.60

    Ligand Information
    Ligands ACT (ACETATE) x 7;PGE (TRIETHYLENE) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals CL (CHLORIDE) x 11

    Jmol

     
    Google Scholar output for 1rfx
    1. Disulfide-dependent multimeric assembly of resistin family hormones
    SD Patel, MW Rajala, L Rossetti, PE Scherer - Science's , 2004 - stke.sciencemag.org
     
    2. SINGLE-CHAIN ANTIPARALLEL COILED COIL PROTEINS
    J Desmet, IJI Lasters, S Loverix - US Patent 20,110,294,983, 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch