The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Disulfide-dependent multimeric assembly of resistin family hormones. Science 304 1154-1158 2004
    Site NYSGXRC
    PDB Id 1rgx Target Id NYSGXRC-T127
    Related PDB Ids 1rfx 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8093,Q9HD89 Molecular Weight 12490.92 Da.
    Residues 114 Isoelectric Point 8.01
    Sequence mknlsfpllflfflvpellgssmplcpideaidkkikqdfnslfpnaikniglncwtvssrgklascpe gtavlscscgsacgswdireekvchcqcaridwtaarccklqvas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.24494
    Matthews' coefficent 2.02 Rfactor 0.20377
    Waters 179 Solvent Content 38.60

    Ligand Information


    Google Scholar output for 1rgx
    1. Disulfide-dependent multimeric assembly of resistin family hormones
    SD Patel, MW Rajala, L Rossetti, PE Scherer - Science's , 2004 - stke.sciencemag.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch