.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rh7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Disulfide-dependent multimeric assembly of resistin family hormones. Science 304 1154-1158 2004
    Site NYSGXRC
    PDB Id 1rh7 Target Id NYSGXRC-T756
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS8121,Q99P86 Molecular Weight 11277.54 Da.
    Residues 105 Isoelectric Point 8.29
    Sequence mkptlcflfilvslfplivpgnaqcsfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtg cacgygcgswdirngntchcqcsvmdwasarccrma
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.11 Rfree 0.2638
    Matthews' coefficent 3.61 Rfactor 0.20117
    Waters 140 Solvent Content 65.60

    Ligand Information
    Ligands P6G (HEXAETHYLENE) x 2
    Metals PT (PLATINUM) x 6

    Jmol

     
    Google Scholar output for 1rh7
    1. Disulfide-dependent multimeric assembly of resistin family hormones
    SD Patel, MW Rajala, L Rossetti, PE Scherer - Science's , 2004 - stke.sciencemag.org
     
    2. Interactions Between Proteins and Platinum-Containing Anti-Cancer Drugs
    C Bischin, A Lupan, V Taciuc - Mini Reviews in , 2011 - ingentaconnect.com
     
    3. SINGLE-CHAIN ANTIPARALLEL COILED COIL PROTEINS
    J Desmet, IJI Lasters, S Loverix - US Patent 20,110,294,983, 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch