.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ri5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase. Mol.Cell 13 77-89 2004
    Site NYSGXRC
    PDB Id 1ri5 Target Id NYSGXRC-T1520
    Molecular Characteristics
    Source Encephalitozoon cuniculi
    Alias Ids TPS8185,Q8SR66 Molecular Weight 34764.79 Da.
    Residues 298 Isoelectric Point 8.99
    Sequence mdsssplktfrkdqamegkkeeirehynsirergresrqrsktinirnannfikaclirlytkrgdsvl dlgcgkggdllkyeragigeyygvdiaevsindarvrarnmkrrfkvffraqdsygrhmdlgkefdvis sqfsfhyafstsesldiaqrniarhlrpggyfimtvpsrdvilerykqgrmsndfykielekmedvpme svreyrftlldsvnncieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskkmglgcltre esevvgiyevvvfrklvpesda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.263
    Matthews' coefficent 1.90 Rfactor 0.23
    Waters 159 Solvent Content 35.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ri5
    1. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch