.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rkq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA. To be Published
    Site NYSGXRC
    PDB Id 1rkq Target Id NYSGXRC-T1436
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8164,401595 Molecular Weight 29588.32 Da.
    Residues 269 Isoelectric Point 5.11
    Sequence aikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhmeqpgdycityn galvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytanrdisyytvhesfvatiplvf ceaekmdpntqflkvmmidepaildqaiaripqevkekytvlksapyfleildkrvnkgtgvksladvl gikpeeimaigdqendiamieyagvgvamdnaipsvkevanfvtksnledgvafaiekyvln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.213
    Matthews' coefficent 2.31 Rfactor 0.177
    Waters 618 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1rkq
    1. HAD superfamily phosphotransferase substrate diversification: structure and function analysis of HAD subclass IIB sugar phosphatase BT4131
    Z Lu, D Dunaway-Mariano, KN Allen - Biochemistry, 2005 - ACS Publications
     
    2. Analysis of the substrate specificity loop of the HAD superfamily cap domain
    SD Lahiri, G Zhang, J Dai, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    3. X-ray crystal structure of the hypothetical phosphotyrosine phosphatase MDP-1 of the haloacid dehalogenase superfamily
    E Peisach, JD Selengut, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    4. Radiation-induced site-specific damage of mercury derivatives: phasing and implications
    UA Ramagopal, Z Dauter, R Thirumuruhan - Section D: Biological , 2005 - scripts.iucr.org
     
    5. Investigation of metal ion binding in phosphonoacetaldehyde hydrolase identifies sequence markers for metal-activated enzymes of the HAD enzyme superfamily
    G Zhang, MC Morais, J Dai, W Zhang - Biochemistry, 2004 - ACS Publications
     
    6. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    7. Competition between protein ligands and cytoplasmic inorganic anions for the metal cation: A DFT/CDM study
    T Dudev, C Lim - Journal of the American Chemical Society, 2006 - ACS Publications
     
    8. ISN1 nucleotidases and HAD superfamily protein fold: in silico sequence and structure analysis
    B Srinivasan, H Balaram - In silico biology, 2007 - IOS Press
     
    9. Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism
    H Yamamoto, K Takio, M Sugahara - Section D: Biological , 2008 - scripts.iucr.org
     
    10. Evolution of structure and function among hotdog-fold thioesterases and HAD family phosphatases
    W Min - 2012 - repository.unm.edu
     
    11. Activity-based functional annotation of unknown proteins: HAD-like hydrolases from E. coli and S. cerevisiae.
    E Kuznetsova - 2009 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch