.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rtt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal. ACTA CRYSTALLOGR.,SECT.D 62 383-391 2006
    Site NYSGXRC
    PDB Id 1rtt Target Id NYSGXRC-T1501
    Related PDB Ids 1x77 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8180,15596401 Molecular Weight 21093.71 Da.
    Residues 193 Isoelectric Point 6.04
    Sequence mslsddikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverfreq iraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtaraqyhlrqtlvfld vhplnkpevmissaqnafdaqgrllddkareliqqqlqalqlwvreggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.28 Rfree 0.228
    Matthews' coefficent 2.35 Rfactor 0.211
    Waters 164 Solvent Content 47.63

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1rtt
    1. Structure determination of an FMN reductase from Pseudomonas aeruginosa PA01 using sulfur anomalous signal
    R Agarwal, JB Bonanno, SK Burley - Section D: Biological , 2006 - scripts.iucr.org
     
    2. Azoreductase from Rhodobacter sphaeroides AS1. 1737 is a flavodoxin that also functions as nitroreductase and flavin mononucleotide reductase
    G Liu, J Zhou, H Lv, X Xiang, J Wang, M Zhou - Applied microbiology and , 2007 - Springer
     
    3. Crystal Structure of ChrRA Quinone Reductase with the Capacity to Reduce Chromate
    S Eswaramoorthy, S Poulain, R Hienerwadel - Plos One, 2012 - dx.plos.org
     
    4. Crystallization and initial X-ray diffraction studies of the flavoenzyme NAD (P) H:(acceptor) oxidoreductase (FerB) from the soil bacterium Paracoccus denitrificans
    T Klumpler, V Sedlacek, J Marek - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Structure Determination and Functional Analysis of a Chromate Reductase from Gluconacetobacter hansenii
    H Jin, Y Zhang, GW Buchko, SM Varnum, H Robinson - PloS one, 2012 - dx.plos.org
     
    6. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch