.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a hypothetical protein, NMB0706. To be Published
    Site NYSGXRC
    PDB Id 1rv9 Target Id NYSGXRC-T895
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS8149,Q9K0A8 Molecular Weight 27128.41 Da.
    Residues 259 Isoelectric Point 5.36
    Sequence mktitetlnlapkgknfltadwpapanvktlittrnggvsqgayqslnlgthvgdnpeavrrnreivqq qvglpvaylnqihstvvvnaaealggtpdadasvddtgkvacavmtadclpvlfcdragtavaaahagw rglaggvlqntiaamkvppvemmaylgpaisadafevgqdvfdafctpmpeaatafegigsgkfladly alarlilkregvggvyggthctvlerdtffsyrrdgatgrmasliwldgnav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.53 Rfree 0.2095
    Matthews' coefficent 2.14 Rfactor 0.1972
    Waters 153 Solvent Content 42.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1rv9
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    3. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     
    4. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch