.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rvk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Evolution of enzymatic activites in the Enolase superfamily: 1.7 A crystal structure of the hypothetical protein MR.GI-17937161 from Agrobacterium tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 1rvk Target Id NYSGXRC-T1522
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8187,17937161 Molecular Weight 42898.40 Da.
    Residues 382 Isoelectric Point 5.69
    Sequence miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrphviekfvkkv ligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpvykliggyrdkvlaygsim cgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmida fhwysrtdalalgrgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagac dilrtgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdy lkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.212
    Matthews' coefficent 2.71 Rfactor 0.193
    Waters 383 Solvent Content 52.72

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1rvk
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. High-throughput computational and experimental techniques in structural genomics
    MR Chance, A Fiser, A Sali, U Pieper, N Eswar - Genome , 2004 - gb.cw.com.tw
     
    3. PDB
    M Von Grotthuss, D Plewczynski, K Ginalski - BMC , 2006 - biomedcentral.com
     
    4. Three-dimensional motifs as signatures of protein function and evolution
    BJ Polacco - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch