.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rw0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical protein yfiH. To be Published
    Site NYSGXRC
    PDB Id 1rw0 Target Id NYSGXRC-T898
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica sero
    Alias Ids TPS8150,Q8Z4J1 Molecular Weight 26386.43 Da.
    Residues 243 Isoelectric Point 5.71
    Sequence mnalivpqwplpkgvaacsstriggvslspydslnlgahcgdnpehveenrkrlfaagnlpskpvwleq vhgknvlrltgepyaskradasysntpgtvcavmtadclpvlfcnregtevaaahagwrglcegvleet vtcfadkpeniiawlgpaigpaafevgpevrdaflakdaqadsaflphgekfladiyqlarqrlantgv ehvyggdrctfsesetffsyrrdkttgrmasfiwli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.29 Rfactor 0.208
    Waters 289 Solvent Content 46.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rw0
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     
    4. Crystal structure of hypothetical protein YfiH from Shigella flexneri at 2 resolution
    Y Kim, N Maltseva, I Dementieva - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch