.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rxd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 1rxd Target Id NYSGXRC-8648a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7911,PF00102, NP_003454 Molecular Weight 19814.07 Da.
    Residues 173 Isoelectric Point 9.17
    Sequence marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldwp fddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedavqfirqkrr gafnskqllylekyrpkmrlrfkdsnghrnncciq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.242
    Matthews' coefficent 3.22 Rfactor 0.223
    Waters 266 Solvent Content 60.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rxd
    1. Structure and biochemical properties of PRL-1, a phosphatase implicated in cell growth, differentiation, and tumor invasion
    JP Sun, WQ Wang, H Yang, S Liu, F Liang - Biochemistry, 2005 - ACS Publications
     
    2. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch