.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Penicillin-binding protein-related factor A from Bacillus Subtilis. To be Published
    Site NYSGXRC
    PDB Id 1rzn Target Id NYSGXRC-T1461
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8167,1146170 Molecular Weight 23826.70 Da.
    Residues 205 Isoelectric Point 9.24
    Sequence irypngktfqpkhsvssqnsqkrapsysnrgmtleddlnetnkyyltnqiavihkkptpvqivnvhypk rsaavikeayfkqssttdyngiykgryidfeaketknktsfplqnfhdhqiehmkqvkaqdgicfviis afdqvyfleadklfyfwdrkekngrksirkdeleetaypislgyapridyisiieqlyfspssgakg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.24507
    Matthews' coefficent 2.60 Rfactor 0.18603
    Waters 80 Solvent Content 52.72

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rzn
    1. The structure of Bacillus subtilis RecU Holliday junction resolvase and its role in substrate selection and sequence-specific cleavage
    N McGregor, S Ayora, S Sedelnikova, B Carrasco - Structure, 2005 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Structure, flexibility, and mechanism of the Bacillus stearothermophilus RecU Holliday junction resolvase
    SJ Kelly, J Li, P Setlow - : Structure, Function, and , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch