.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phenazine biosynthesis protein from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 1s7j Target Id NYSGXRC-T1581
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8197,29374770 Molecular Weight 30705.28 Da.
    Residues 274 Isoelectric Point 5.30
    Sequence mslsypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalrwftpere idlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilperipilpeyeaalgtk iyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtasgdsvdfvsrtffpklrinedpvcgs ahanlipywgkrlnqttlsayqvsprggfltcevkenrviiggtaklfakgeaylpveggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.273
    Matthews' coefficent 2.38 Rfactor 0.229
    Waters 348 Solvent Content 47.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s7j
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. Structure and function of the phenazine biosynthetic protein PhzF from Pseudomonas fluorescens
    W Blankenfeldt, AP Kuzin, T Skarina - Proceedings of the , 2004 - National Acad Sciences
     
    3. Structure and function of the phenazine biosynthesis protein PhzF from Pseudomonas fluorescens 2-79
    JF Parsons, F Song, L Parsons, K Calabrese - Biochemistry, 2004 - ACS Publications
     
    4. Crystal structure of YHI9, the yeast member of the phenazine biosynthesis PhzF enzyme superfamily
    D Liger, S Quevillon_Cheruel, I Sorel - Proteins: Structure, , 2005 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch