.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sef

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of conserved hypothetical protein from Enterococcus Faecalis V583. To be Published
    Site NYSGXRC
    PDB Id 1sef Target Id NYSGXRC-T1582
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8198,29377458 Molecular Weight 31004.23 Da.
    Residues 274 Isoelectric Point 5.21
    Sequence mslmgyknnrvgyqkelltsravikkdnyaiiphdglvqnavpgfenvdisilgspklgatfvdyiatf hkngqqttgfggdgiqtlvyvidgrlrvsdgqetheleaggyayftpemkmylanaqeadtevflykkr yqplaghqpykvvgsihdqqpeeyegmtdvllwsllpkefdfdmnmhilsfepgashayiethvqehga ylisgqgmynldnewypvekgdyifmsayvpqaayavgreeplmyvyskdanrepeleggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.221
    Matthews' coefficent 3.55 Rfactor 0.208
    Waters 136 Solvent Content 63.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sef
    1. Prediction of transition metal_binding sites from apo protein structures
    M Babor, S Gerzon, B Raveh - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. The GD box: A widespread noncontiguous supersecondary structural element
    V Alva, S Dunin_Horkawicz, M Habeck - Protein , 2009 - Wiley Online Library
     
    3. Structural and Functional Insights into (S)-Ureidoglycine Aminohydrolase, Key Enzyme of Purine Catabolism in Arabidopsis thaliana
    I Shin, R Percudani, S Rhee - Journal of Biological Chemistry, 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch