.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sfn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein from Deinicoccus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 1sfn Target Id NYSGXRC-T1583
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8199,15806172 Molecular Weight 28684.03 Da.
    Residues 257 Isoelectric Point 5.77
    Sequence mslkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempagaqatesv yqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekpyqtvegvqapgvywgn erenpgypfegddhliarkllpdepafdfmvstmsfapgaslpyaevhymehgllmlegeglykleeny ypvtagdiiwmgahcpqwygalgrnwskyllykdmnrhpleggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.278
    Matthews' coefficent 2.64 Rfactor 0.229
    Waters 78 Solvent Content 53.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sfn
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Structural and Functional Insights into (S)-Ureidoglycine Aminohydrolase, Key Enzyme of Purine Catabolism in Arabidopsis thaliana
    I Shin, R Percudani, S Rhee - Journal of Biological Chemistry, 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch