.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sg9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure. Proteins 71 1038-1041 2008
    Site NYSGXRC
    PDB Id 1sg9 Target Id NYSGXRC-T1418
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8162,P45873 Molecular Weight 32829.83 Da.
    Residues 293 Isoelectric Point 5.80
    Sequence sldtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrile lvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgsgaigv svakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasiemilsnppyvkssah lpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkkivsdtvflkdsagkyrfl llnrrsseggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.261
    Matthews' coefficent 4.17 Rfactor 0.235
    Waters 236 Solvent Content 70.51

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 3;GLN x 3
    Metals

    Jmol

     
    Google Scholar output for 1sg9
    1. The SKE_DOCK server and human teams based on a combined method of shape complementarity and free energy estimation
    G Terashi, M Takeda_Shitaka, K Kanou - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    3. A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure
    R Agarwal, SK Burley - : Structure, Function, and , 2008 - Wiley Online Library
     
    4. 14 Modification of glutamine residues in proteins involved in translation
    HL Schubert - The Enzymes, 2006 - Elsevier
     
    5. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch