.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sgj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of citrate lyase beta subunit. To be Published
    Site NYSGXRC
    PDB Id 1sgj Target Id NYSGXRC-T1506
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8182,15806259 Molecular Weight 31331.74 Da.
    Residues 296 Isoelectric Point 5.50
    Sequence mslnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardliaaap hlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplpilagletgagvwn areimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaarltgvaaldivvtalndpetfra daeqgralgysgklcihpaqvalaheyfgpteadrararalldaaaaaaqrghgafsfegqmvdepmla kartllsheaeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.84 Rfree 0.243
    Matthews' coefficent 3.01 Rfactor 0.2268
    Waters 546 Solvent Content 59.17

    Ligand Information
    Ligands OAA (OXALOACETATE) x 3
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 1sgj
    1. Structure and mechanism of HpcH: a metal ion dependent class II aldolase from the homoprotocatechuate degradation pathway of Escherichia coli
    D Rea, V Flp, TDH Bugg, DI Roper - Journal of molecular biology, 2007 - Elsevier
     
    2. Structural insights into RipC, a putative citrate lyase subunit from a Yersinia pestis virulence operon
    R Torres, N Chim, B Sankaran, C Pujol - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch