.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sv6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-hydroxypentadienoic acid hydratase from Escherichia Coli. To be Published
    Site NYSGXRC
    PDB Id 1sv6 Target Id NYSGXRC-T795
    Molecular Characteristics
    Source Pseudomonas aeruginosa.
    Alias Ids TPS8135,Q9HWQ4 Molecular Weight 30340.72 Da.
    Residues 282 Isoelectric Point 5.60
    Sequence slvmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgrkvglthp kvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpatditfdelynaiewvlp alevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlkncamkmtrnneevssgrgseclghp lnaavwlarkmaslgeplrtgdiiltgalgpmvavnagdrfeahiegigsvaatfssaapkgslseggs hhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.90 Rfree 0.267
    Matthews' coefficent 2.59 Rfactor 0.239
    Waters Solvent Content 52.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sv6
    1. Structural Insight into Substrate Binding and Catalysis of a Novel 2-Keto-3- deoxy-d-arabinonate Dehydratase Illustrates Common Mechanistic Features of the
    SJJ Brouns, TRM Barends, P Worm, J Akerboom - Journal of molecular , 2008 - Elsevier
     
    2. Structure and Mechanism of HpcG, a Hydratase in the Homoprotocatechuate Degradation Pathway of Escherichia coli
    A Izumi, D Rea, T Adachi, S Unzai, SY Park - Journal of molecular , 2007 - Elsevier
     
    3. Expression, purification and crystallization of 2-oxo-hept-4-ene-1, 7-dioate hydratase (HpcG) from Escherichia coli C
    T Adachi, A Izumi, D Rea, SY Park - Section F: Structural , 2006 - scripts.iucr.org
     
    4. Assembly of a 20-nm Protein Cage by Escherichia coli 2-Hydroxypentadienoic Acid Hydratase
    MG Montgomery, AR Coker, IA Taylor - Journal of molecular , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch