.
The Open Protein Structure Annotation Network
PDB Keyword
.

1szq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-methylcitrate dehydratase. To be Published
    Site NYSGXRC
    PDB Id 1szq Target Id NYSGXRC-T819
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8141,P77243 Molecular Weight 53817.63 Da.
    Residues 482 Isoelectric Point 5.68
    Sequence saqinnirpefdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkllgpivpgtvv pngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggilatadwlsrnavasgkapl tmkqvltamikaheiqgcialensfnrvgldhvllvkvastavvaemlgltreeilnavslawvdgqsl rtyrhapntgtrkswaagdatsravrlalmaktgemgypsaltapvwgfydvsfkgesfrfqrpygsyv menvlfkisfpaefhsqtaveaamtlyeqmqaagktaadiekvtirtheaciriidkkgplnnpadrdh ciqymvaipllfgrltaadyednvaqdkridalrekincfedpaftadyhdpekraianaitleftdgt rfeevvveypigharrrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldlyvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.247
    Matthews' coefficent 2.81 Rfactor 0.204
    Waters 162 Solvent Content 55.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1szq
    1. Three-dimensional structure of iminodisuccinate epimerase defines the fold of the MmgE/PrpD protein family
    B Lohkamp, B Buerle, PG Rieger - Journal of molecular , 2006 - Elsevier
     
    2. Preliminary X-ray crystallographic analysis of 2-methylcitrate synthase from Salmonella typhimurium
    S Chittori, DK Simanshu, HS Savithri - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch