.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved hypothetical protein Pseudomonas aeruginosa PA01. To be Published
    Site NYSGXRC
    PDB Id 1t3u Target Id NYSGXRC-T1445
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8165,15600420 Molecular Weight 11194.90 Da.
    Residues 99 Isoelectric Point 5.69
    Sequence sqsntltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnithdllhrk erldqessstrervrelldrvdralanpad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.29
    Matthews' coefficent 2.16 Rfactor 0.236
    Waters 48 Solvent Content 42.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t3u
    1. Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable data sets
    H Cheng, BH Kim, NV Grishin - Journal of molecular biology, 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch