.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t5j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Hypothetical protein MJ1187 from Methanococcus jannaschii. To be Published
    Site NYSGXRC
    PDB Id 1t5j Target Id NYSGXRC-T779
    Molecular Characteristics
    Source Methanococcus jannaschii.
    Alias Ids TPS8126,Q58588 Molecular Weight 33565.78 Da.
    Residues 301 Isoelectric Point 5.48
    Sequence mvkmrdkilgsvfgavigdalgmptenltkeeikklygfvdsyvepknylagklnkgewtddteqaicl iksltkegidikkfancliawknknppdigltslmaidklenndysgvdssscgaamriyplgivfhnn lkklkeevikaskithnnktaiagalaiaffvssalkdrkdfslldecynyikdideefakklleiknf nnldyiydyfgtgvktdevvpsaiatylltdnfkegmlkcinaggdtdslasmygamagayygfknipk ewidglknkevifelaerlyhlate
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.265
    Matthews' coefficent 2.43 Rfactor 0.204
    Waters 49 Solvent Content 51.40

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1t5j
    1. The structure of human ADP-ribosylhydrolase 3 (ARH3) provides insights into the reversibility of protein ADP-ribosylation
    C Mueller-Dieckmann, S Kernstock - Proceedings of the , 2006 - National Acad Sciences
     
    2. Mechanism of ADP-ribosylation removal revealed by the structure and ligand complexes of the dimanganese mono-ADP-ribosylhydrolase DraG
    CL Berthold, H Wang, S Nordlund - Proceedings of the , 2009 - National Acad Sciences
     
    3. Structure of mouse ADP-ribosylhydrolase 3 (mARH3)
    C Mueller-Dieckmann, S Kernstock - Section F: Structural , 2008 - scripts.iucr.org
     
    4. Crystal Structure of Dinitrogenase Reductase-activating Glycohydrolase (DRAG) Reveals Conservation in the ADP-Ribosylhydrolase Fold and Specific Features in the
    XD Li, LF Huergo, A Gasperina, FO Pedrosa - Journal of molecular , 2009 - Elsevier
     
    5. BCL:: EM-Fit: Rigid body fitting of atomic structures into density maps using geometric hashing and real space refinement
    N Woetzel, S Lindert, PL Stewart, J Meiler - Journal of Structural Biology, 2011 - Elsevier
     
    6. Polymorphic toxin systems: comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative
    D Zhang, RF de Souza, V Anantharaman, LM Iyer - Biology , 2012 - biology-direct.com
     
    7. Cloning, expression, purification and crystallization as well as X-ray fluorescence and preliminary X-ray diffraction analyses of human ADP-ribosylhydrolase 1
    S Kernstock, F Koch-Nolte - Section F: Structural , 2009 - scripts.iucr.org
     
    8. Crystal Structure of Dinitrogenase Reductase-activating Glycohydrolase (DRAG) Reveals Conservation in the ADP-Ribosylhydrolase Fold and Specific
    FO Pedrosa, M Merrick, FK Winkler - CEP, 2009 - jic.ac.uk
     
    9. Structural and Biochemical Studies of the Human DEAD-box Helicase Dbp5 and Nucleoporin Nup214 Involved in mRNA Export
    H Moeller - 2009 - edoc.ub.uni-muenchen.de
     
    10. A1 Protein Function and Ageing
    C Franceschi - genetics, 2005 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch