.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the translation initiation factor eIF-2B, subunit delta, from A. fulgidus. to be published
    Site NYSGXRC
    PDB Id 1t5o Target Id NYSGXRC-T1589
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS8201,11497982 Molecular Weight 38982.64 Da.
    Residues 351 Isoelectric Point 5.31
    Sequence mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygialaarerefad vdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalreaeklaeedvernrkmge ygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkeirviacetrplnqgsrltcwelmedgi dvtlitdsmvgivmqkgmvdkvivgadrivrdavfnkigtytvsvvakhhnipfyvaapkatfdwerta kdvvieerpreelifcgkrqiaplnvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggs hhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.246
    Matthews' coefficent 2.64 Rfactor 0.197
    Waters 1398 Solvent Content 53.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t5o
    1. Translation initiation: structures, mechanisms and evolution
    A Marintchev, G Wagner - Quarterly reviews of biophysics, 2004 - Cambridge Univ Press
     
    2. Protein synthesis and its control in neuronal cells with a focus on vanishing white matter disease
    GD Pavitt, CG Proud - Biochemical Society Transactions, 2009 - www-06.all-portland.net
     
    3. Enzymatic characterization of 5-methylthioribose 1-phosphate isomerase from Bacillus subtilis
    Y Saito, H Ashida, C Kojima, H Tamura - Bioscience, , 2007 - J-STAGE
     
    4. Crystal structure of 5_methylthioribose 1_phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
    H Tamura, Y Saito, H Ashida, T Inoue, Y Kai - Protein , 2008 - Wiley Online Library
     
    5. Crystal Structure of the [alpha] Subunit of Human Translation Initiation Factor 2B
    TB Hiyama, T Ito, H Imataka, S Yokoyama - Journal of molecular biology, 2009 - Elsevier
     
    6. The molecular basis of translational control
    CS Fraser - Progress in Molecular Biology and Translational , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch