.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t62

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein [gi:29377587] from Enterococcus faecalis v583. To be Published
    Site NYSGXRC
    PDB Id 1t62 Target Id NYSGXRC-T1587
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS8200,29377587 Molecular Weight 19465.07 Da.
    Residues 168 Isoelectric Point 4.71
    Sequence msllknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykmeeeqlpk agqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeharffkeelapyqlqfy pdmllvcqsfevvdlytekeeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.263
    Matthews' coefficent 3.08 Rfactor 0.215
    Waters Solvent Content 58.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t62
    1. Protein structure prediction using a variety of profile libraries and 3D verification
    K Tomii, T Hirokawa, C Motono - : Structure, Function, and , 2005 - Wiley Online Library
     
    2. The global trace graph, a novel paradigm for searching protein sequence databases
    A Heger, S Mallick, C Wilton, L Holm - Bioinformatics, 2007 - Oxford Univ Press
     
    3. Protein structure prediction in CASP6 using CHIMERA and FAMS
    M Takeda_Shitaka, G Terashi, D Takaya - PROTEINS: , 2005 - Wiley Online Library
     
    4. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    5. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch