.
The Open Protein Structure Annotation Network
PDB Keyword
.

1te5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of amidophosphoribosyltransferase from Pseudomonas aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 1te5 Target Id NYSGXRC-T1580
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8196,15596504 Molecular Weight 29640.97 Da.
    Residues 267 Isoelectric Point 5.86
    Sequence mslcellgmsanvptdivfsftglmqrgggtgphrdgwgiafyegrgvrlfqdplasvdsevarlvqrf piksetvighirqanvgkvglsnthpfirelggrywtfahngqladfqpkpgfyrpvgetdseaafcdl lnrvrrafpepvpvevllpvlisacdeyrkkgvfnalisdgdwlftfcssklayitrrapfgparlkda dltvdfhaettpddvvtviatepltdnenwtlqqsgewvlwwggevlakgeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.278
    Matthews' coefficent 2.30 Rfactor 0.243
    Waters 191 Solvent Content 45.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1te5
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. The generation of new protein functions by the combination of domains
    M Bashton, C Chothia - Structure, 2007 - Elsevier
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch