.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tel

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a RubisCO-like protein from Chlorobium tepidum. To be Published
    Site NYSGXRC
    PDB Id 1tel Target Id NYSGXRC-T1798
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS8244,21674586 Molecular Weight 48000.41 Da.
    Residues 435 Isoelectric Point 5.17
    Sequence mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfrlvhaakvid yevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmdihfp dtyladfegpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemladvt wssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallinalpvglsavrml snytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfgdrmmtpeeevlenviectkp mgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisiet waethpelqamvdqsllkkqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.248
    Matthews' coefficent 2.39 Rfactor 0.209
    Waters 47 Solvent Content 45.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tel
    1. Structure and function of Rubisco
    I Andersson, A Backlund - Plant Physiology and Biochemistry, 2008 - Elsevier
     
    2. Function, structure, and evolution of the RubisCO-like proteins and their RubisCO homologs
    FR Tabita, TE Hanson, H Li, S Satagopan - Microbiology and , 2007 - Am Soc Microbiol
     
    3. Mechanistic diversity in the RuBisCO superfamily: the enolase in the methionine salvage pathway in Geobacillus kaustophilus
    HJ Imker, AA Fedorov, EV Fedorov, SC Almo - Biochemistry, 2007 - ACS Publications
     
    4. Mechanistic Diversity in the RuBisCO Superfamily: A Novel Isomerization Reaction Catalyzed by the RuBisCO-like Protein from Rhodospirillum rubrum
    HJ Imker, J Singh, BP Warlick, FR Tabita, JA Gerlt - Biochemistry, 2008 - ACS Publications
     
    5. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    6. BMB| CR
    AB Lorentzena, C Mitchelmorea - 2012 - forskning.ruc.dk
     
    7. Evidence that the amino acid residue Ile121 is involved in arginine kinase activity and structural stability
    QY Wu, F Li, XY Wang, KL Xu - International Journal of Biological , 2012 - Elsevier
     
    8. Increased expression level and catalytic activity of internally-duplicated carbonic anhydrase from Dunaliella species by reconstitution of two separate domains
    MR Ki, BK Kanth, KH Min, J Lee, SP Pack - Process Biochemistry, 2012 - Elsevier
     
    9. Listeria monocytogenes EGD-e is unable to grow anaerobically due to a deletion in the class III NrdD ribonucleotide reductase: implications for its use as a model
    A Ofer, J Kreft, DT Logan, G Cohen - Journal of , 2011 - Am Soc Microbiol
     
    10. Extraction, purification and characterization of the plant-produced HPV16 subunit vaccine candidate E7 GGG
    JF Buyel, JA Bautista, R Fischer, VM Yusibov - Journal of Chromatography , 2011 - Elsevier
     
    11. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch