.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tik

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF ACYL CARRIER PROTEIN PHOSPHODIESTERASE. To be Published
    Site NYSGXRC
    PDB Id 1tik Target Id NYSGXRC-T1480
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8175,16129373 Molecular Weight 23009.81 Da.
    Residues 213 Isoelectric Point 5.67
    Sequence mslskvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrpsdaplt prqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfrytengpeglvtgkkai vitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygpemaakaqsdakaaidsivsaeggs hhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.232
    Matthews' coefficent 2.64 Rfactor 0.186
    Waters 175 Solvent Content 53.00

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1tik
    1. Evaluation of models for the evolution of protein sequences and functions under structural constraint
    S Rastogi, N Reuter, DA Liberles - Biophysical chemistry, 2006 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch