.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tk9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of two putative phosphoheptose isomerases. Proteins 63 1092-1096 2006
    Site NYSGXRC
    PDB Id 1tk9 Target Id NYSGXRC-T1512
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS8183,15792473 Molecular Weight 21437.53 Da.
    Residues 198 Isoelectric Point 6.40
    Sequence mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhfaaelsgryk kerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligistsgkspnvlealkkakelnm lclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtlcqiidesfeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.211
    Matthews' coefficent 2.42 Rfactor 0.182
    Waters 699 Solvent Content 48.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tk9
    1. Structure and function of sedoheptulose-7-phosphate isomerase, a critical enzyme for lipopolysaccharide biosynthesis and a target for antibiotic adjuvants
    PL Taylor, KM Blakely, GP de Leon, JR Walker - Journal of Biological , 2008 - ASBMB
     
    2. Structural similarity between the DnaA_binding proteins HobA (HP1230) from Helicobacter pylori and DiaA from Escherichia coli
    G Natrajan, DR Hall, AC Thompson - Molecular , 2007 - Wiley Online Library
     
    3. N-acetylmuramic acid 6-phosphate lyases (MurNAc etherases): role in cell wall metabolism, distribution, structure, and mechanism
    T Jaeger, C Mayer - Cellular and Molecular Life Sciences, 2008 - Springer
     
    4. The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site
    NJ Harmer - Journal of molecular biology, 2010 - Elsevier
     
    5. Predicting conserved essential genes in bacteria: in silico identification of putative drug targets
    M Duffield, I Cooper, E McAlister, M Bayliss, D Ford - Mol. BioSyst., 2010 - xlink.rsc.org
     
    6. Crystal structures of two putative phosphoheptose isomerases
    J Seetharaman, KR Rajashankar - Proteins: Structure, , 2006 - Wiley Online Library
     
    7. Crystal structure of YfeU protein from Haemophilus influenzae: a predicted etherase involved in peptidoglycan recycling
    Y Kim, P Quartey, R Ng, TI Zarembinski - Journal of structural and , 2009 - Springer
     
    8. Crystallographic and NMR Studies of Aquifex Aeolicus Phosphoheptose Isomerase: Structural Insights into the Mechanism of Aldose-Ketose Isomerization.
    V Thai, G Petsko, D Kern - The role of structure and dynamics in , 2007 - books.google.com
     
    9. In silico quest for putative drug targets in Helicobacter pylori HPAG1: molecular modeling of candidate enzymes from lipopolysaccharide biosynthesis pathway
    M Sarkar, L Maganti, N Ghoshal, C Dutta - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch