.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tlq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1tlq Target Id NYSGXRC-T1519
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8184,16079242 Molecular Weight 21254.19 Da.
    Residues 189 Isoelectric Point 5.05
    Sequence mslkkytmnemvditkdmlnkrgvmiediarivqklqekynpnlplsvcmenvekvlnkreiihavltg laldqlaeqkllpeplqhlvetdeplygideiiplsivnvygsigltnfgyldkekigiikeldespdg ihtflddivaalaaaaasriahthqdlqdeekeqdekpvvseggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.29466
    Matthews' coefficent 3.12 Rfactor 0.23244
    Waters 24 Solvent Content 60.22

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1tlq
    1. Dynamics of essential collective motions in proteins: Theory
    M Stepanova - Physical Review E, 2007 - APS
     
    2. Crystal structure of phosphatidylglycerophosphatase (PGPase), a putative membrane_bound lipid phosphatase, reveals a novel binuclear metal binding site and two
    D Kumaran, JB Bonanno, SK Burley - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch