.
The Open Protein Structure Annotation Network
PDB Keyword
.

1to3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of yiht from Salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 1to3 Target Id NYSGXRC-T764
    Molecular Characteristics
    Source Salmonella typhimurium.
    Alias Ids TPS8123,Q9L7R9 Molecular Weight 31864.09 Da.
    Residues 292 Isoelectric Point 7.62
    Sequence mnnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspyasavlldqqf cyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdgakalkllvlwrsdedaqqr lnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiidaakelgdsgadlykvemplygkgarsdl ltasqrlnghinmpwvilssgvdeklfpravrvameagasgflagravwssviglpdtelmlrdvsapk lqrlgeivdemmakrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.20825
    Matthews' coefficent 3.87 Rfactor 0.17867
    Waters 120 Solvent Content 67.95

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals BR (BROMIDE) x 9

    Jmol

     
    Google Scholar output for 1to3
    1. Efficient generalized Born models for Monte Carlo simulations
    J Michel, RD Taylor, W Jonathan - Journal of Chemical Theory , 2006 - ACS Publications
     
    2. Predicting DNA_binding amino acid residues from electrostatic stabilization upon mutation to Asp/Glu and evolutionary conservation
    YC Chen, CY Wu, C Lim - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    3. Structure of 2-amino-3, 7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids
    M Morar, RH White, SE Ealick - Biochemistry, 2007 - ACS Publications
     
    4. Thermodynamic analysis of water molecules at the surface of proteins and applications to binding site prediction and characterization
    T Beuming, Y Che, R Abel, B Kim - Proteins: Structure, , 2012 - Wiley Online Library
     
    5. Multi-crystal anomalous diffraction for low-resolution macromolecular phasing
    Q Liu, Z Zhang, WA Hendrickson - Acta Crystallographica Section D: , 2010 - scripts.iucr.org
     
    6. STRUCTURE OF A CLASS I TAGATOSE-1, 6-BIPHOSPHATE ALDOLASE: STUDY INTO AN APPARENT LOSS OF STEREOSPECIFICITY
    C LowKam, B Liotard, J Sygusch - 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch