.
The Open Protein Structure Annotation Network
PDB Keyword
.

1to6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Glycerate kinase from Neisseria meningitidis (serogroup A). To be Published
    Site NYSGXRC
    PDB Id 1to6 Target Id NYSGXRC-T831
    Molecular Characteristics
    Source Neisseria meningitidis (serogroup a).
    Alias Ids TPS8143,P57098 Molecular Weight 39524.05 Da.
    Residues 371 Isoelectric Point 4.90
    Sequence mkiviapdsfkesltaqqvaeaikrgfqqsiadvecllcpvgdggegtvdairhsldleekclqvtgsf gqkevmryfqkeqlalfevadlvglgkiplekrnplqiqtrgigelirhlisqeikeiyigvggtasnd ggigiaaglgyqfydedgnalpacgqsllnlasvstenrykipedvhiriladvvsplcghqgatytfg kqkgldstmfevvdqaiqdfyekvspatlklkgagagggiagglcafaqasivsgidtcldlidfdkkv sdvdlvivgegrldrqslagkapigvakrtpvgvpvvaicgslvedlpslpfeniqaafsilekseple dslknaslylehtasnighllnmpki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.283
    Matthews' coefficent 2.50 Rfactor 0.226
    Waters 195 Solvent Content 50.84

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1to6
    1. A comprehensive update of the sequence and structure classification of kinases
    S Cheek, K Ginalski, H Zhang - BMC Structural , 2005 - biomedcentral.com
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Crystal structure of a glycerate kinase (TM1585) from Thermotoga maritima at 2.70 resolution reveals a new fold
    R Schwarzenbacher, D McMullan - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Multi-crystal anomalous diffraction for low-resolution macromolecular phasing
    Q Liu, Z Zhang, WA Hendrickson - Acta Crystallographica Section D: , 2010 - scripts.iucr.org
     
    5. Glycerate 2-kinase of Thermotoga maritima and genomic reconstruction of related metabolic pathways
    C Yang, DA Rodionov, IA Rodionova, X Li - Journal of , 2008 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch