.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tq8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of hypothetical protein Rv1636 from Mycobacterium tuberculosis H37Rv. To be Published
    Site NYSGXRC
    PDB Id 1tq8 Target Id NYSGXRC-T1533
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS8189,15608774 Molecular Weight 17104.28 Da.
    Residues 163 Isoelectric Point 6.09
    Sequence mghhhhhhgghmslsayktvvvgtdgsdssmravdraaqiagadakliiasaylpqhedaraadilkde sykvtgtapiyeilhdakerahnagaknveerpivgapvdalvnladeekadllvvgnvglstiagrll gsvpanvsrrakvdvlivhtteggs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.40 Rfree 0.262
    Matthews' coefficent 2.57 Rfactor 0.221
    Waters 216 Solvent Content 51.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tq8
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     
    2. The Structure and Function of a Novel Glycerophosphodiesterase from Enterobacter aerogenes
    CJ Jackson, PD Carr, JW Liu, SJ Watt, JL Beck - Journal of molecular , 2007 - Elsevier
     
    3. Structural genomics as an approach towards understanding the biology of tuberculosis
    EN Baker - Journal of structural and functional genomics, 2007 - Springer
     
    4. Biochemical properties of UspG, a universal stress protein of Escherichia coli
    A Weber, K Jung - Biochemistry, 2006 - ACS Publications
     
    5. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch