.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tt7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structural study of Hypothetical protein yhfp. To be Published
    Site NYSGXRC
    PDB Id 1tt7 Target Id NYSGXRC-T786
    Related PDB Ids 1y9e 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8130,2633368, O07615 Molecular Weight 34754.56 Da.
    Residues 330 Isoelectric Point 4.91
    Sequence mstlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivreyplilgida agtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnlslkeamvygtagftaals vhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnreaadylkqlgasevisredvyd gtlkalskqqwqgavdpvggkqlasllskiqyggsvavsgltgggevpatvypfilrgvsllgidsvyc pmdvraavwermssdlkpdqlltivdrevsleetpgalkdilqnriqgrvivkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.26192
    Matthews' coefficent 2.74 Rfactor 0.18729
    Waters 160 Solvent Content 54.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tt7
    1. Medium-and short-chain dehydrogenase/reductase gene and protein families
    H Eklund, S Ramaswamy - Cellular and molecular life sciences, 2008 - Springer
     
    2. The nucleotide sequence of a Polish isolate of Tomato torrado virus
    M Budziszewska, A Obrepalska-Steplowska - Virus genes, 2008 - Springer
     
    3. Identifying Horizontal Gene Transfer Using Anomalies In Protein Structures And Sequences
    VRB Santosh - 2011 - digitalcommons.unl.edu
     
    4. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch