.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tuf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cocrystal structures of diaminopimelate decarboxylase: mechanism, evolution, and inhibition of an antibiotic resistance accessory factor. Structure 10 1499-1508 2002
    Site NYSGXRC
    PDB Id 1tuf Target Id NYSGXRC-T135
    Related PDB Ids 1twi 
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8102,Q58497 Molecular Weight 48897.17 Da.
    Residues 438 Isoelectric Point 5.78
    Sequence mkimflgndtveikdgrffidgydaielaekfgtplyvmseeqikinynryieafkrweeetgkefiva yaykananlaitrllaklgcgadvvsggelyiaklsnvpskkivfngncktkeeiimgieanirafnvd siselilinetakelgetanvafrinpnvnpkthpkistglkknkfgldvesgiamkaikmalemeyvn vvgvhchigsqltdispfieetrkvmdfvvelkeegieiedvnlggglgipyykdkqiptqkdladaii ntmlkykdkvempnlilepgrslvatagyllgkvhhiketpvtkwvmidagmndmmrpamyeayhhiin ckvknekevvsiagglcessdvfgrdreldkvevgdvlaifdvgaygismannynargrprmvltskkg vflireretyadliakdivpphll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.253
    Matthews' coefficent 2.45 Rfactor 0.204
    Waters 292 Solvent Content 49.40

    Ligand Information
    Ligands AZ1 (AZELAIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1tuf
    1. Pyridoxal 5-phosphate enzymes as targets for therapeutic agents
    A Amadasi, M Bertoldi, R Contestabile - Current medicinal , 2007 - ingentaconnect.com
     
    2. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of LysA (Rv1293) from Mycobacterium tuberculosis
    G Kefala, LJ Perry, MS Weiss - Acta Crystallographica Section F: , 2005 - scripts.iucr.org
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Structural modeling and environmental regulation of arginine decarboxylase in Synechocystis sp. PCC 6803
    S Jantaro, H Kidron, D Chesnel, A Incharoensakdi - Archives of , 2006 - Springer
     
    5. The Catalytic Intermediate Stabilized by a Down Active Site Loop for Diaminopimelate Decarboxylase from Helicobacter pylori
    T Hu, D Wu, J Chen, J Ding, H Jiang, X Shen - Journal of Biological , 2008 - ASBMB
     
    6. Drug efficiency indices for improvement of molecular docking scoring functions
    AT Garca_Sosa, C Hetnyi - Journal of computational , 2010 - Wiley Online Library
     
    7. The three-dimensional structure of diaminopimelate decarboxylase from Mycobacterium tuberculosis reveals a tetrameric enzyme organisation
    S Weyand, G Kefala, DI Svergun, MS Weiss - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch