.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tvf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of penicillin-binding protein 4 (PBP4) from Staphylococcus aureus. To be Published
    Site NYSGXRC
    PDB Id 1tvf Target Id NYSGXRC-T72
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS8091,P72355 Molecular Weight 48234.99 Da.
    Residues 431 Isoelectric Point 9.23
    Sequence mknlisiiiilcltlsimtpyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidt kwnpasmtklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsn ssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvttard yaildlhviketpkildftkqlapttlavtyytfnfslegakmslpgtdglktgssdtanynhtittkr gkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskgeqringkkyyvendlydvlps dfskkdyklvvedgkvhadyprefinkdygpptvevhqpiiqkantvaksmweehplftiiggtclvag lalivhmiinrlfrkrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.205
    Matthews' coefficent 2.58 Rfactor 0.166
    Waters 781 Solvent Content 51.95

    Ligand Information
    Ligands SO4 (SULFATE) x 5;UNL (UNKNOWN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1tvf
    1. The penicillin_binding proteins: structure and role in peptidoglycan biosynthesis
    E Sauvage, F Kerff, M Terrak, JA Ayala - FEMS microbiology , 2008 - Wiley Online Library
     
    2. Bacterial peptidoglycan (murein) hydrolases
    W Vollmer, B Joris, P Charlier - FEMS microbiology , 2008 - Wiley Online Library
     
    3. Penicillin binding proteins: key players in bacterial cell cycle and drug resistance processes
    P Macheboeuf, C Contreras_Martel - FEMS microbiology , 2006 - Wiley Online Library
     
    4. Penicillin-binding protein 7/8 contributes to the survival of Acinetobacter baumannii in vitro and in vivo
    TA Russo, U MacDonald, JM Beanan - Journal of Infectious , 2009 - jid.oxfordjournals.org
     
    5. Identification of a new family of enzymes with potential O-acetylpeptidoglycan esterase activity in both Gram-positive and Gram-negative bacteria
    J Weadge, J Pfeffer, A Clarke - BMC microbiology, 2005 - biomedcentral.com
     
    6. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    7. Design, synthesis, and structureactivity relationship study of 5-amido-1-(2, 4-dinitrophenyl)-1H-4-pyrazolecarbonitrils as DD-carboxypeptidase/penicillin-binding
    H Sadeghian, A Sadeghian, M Pordel - Medicinal Chemistry , 2010 - Springer
     
    8. Description and recognition of regular and distorted secondary structures in proteins using the automated protein structure analysis method
    S Ranganathan, D Izotov, E Kraka - Structure, Function, and , 2009 - Wiley Online Library
     
    9. Systems Biology and Bioinformatics in Medical Applications
    BA Holm - 2009 - DTIC Document
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch