.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tvl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YTNJ from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1tvl Target Id NYSGXRC-T773
    Related PDB Ids 1yw1 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8124,O34974, 2635396 Molecular Weight 49408.75 Da.
    Residues 442 Isoelectric Point 5.76
    Sequence mtradfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfiseksiph flnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggragwnlvtspqegaarnhs ksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffdqaklhrlnhkgkyfqvegplnigrs kqgepvvfqagssetgrqfaaknadaifthsnsleetkafyadvksraadegrdpssvrifpgispiva dteeeaekkyrefaelipienavtylarffddydlsvypldepfpdigdvgknafqsttdrikreakar nltlrevaqemafprtlfigtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyr qdyrggtlrenlglgipqhqsvlhsshh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.22801
    Matthews' coefficent 3.60 Rfactor 0.20668
    Waters 231 Solvent Content 65.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tvl
    1. Metalloproteomics: high-throughput structural and functional annotation of proteins in structural genomics
    W Shi, C Zhan, A Ignatov, BA Manjasetty, N Marinkovic - Structure, 2005 - Elsevier
     
    2. Crystal structure of long-chain alkane monooxygenase (LadA) in complex with coenzyme FMN: unveiling the long-chain alkane hydroxylase
    L Li, X Liu, W Yang, F Xu, W Wang, L Feng - Journal of molecular , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch