.
The Open Protein Structure Annotation Network
PDB Keyword
.

1twy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical ABC-type phosphate transporter. To be Published
    Site NYSGXRC
    PDB Id 1twy Target Id NYSGXRC-T1771
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8238,15601562 Molecular Weight 31745.41 Da.
    Residues 290 Isoelectric Point 6.41
    Sequence mslirmalaavcallfsittmtpfvqaseitisgstsvarimdvlaekynqqhpetyvavqgvgstagi sllkkgvadiamtsrylteseaqntlhtftlafdglaivvnqanpvtnltreqlygiykgqitnwkqvg gndqkiavvtreassgtrysfeslmgltktvkdrevsdvaptalvvnsnsmmktlvnhntqavgfisig svdksvkaiqfekadptsdniakhtyqlsrpflilhysdnadeqtkefiaflksesakkliveygyimp sdveeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.65 Rfree 0.23062
    Matthews' coefficent 2.12 Rfactor 0.19275
    Waters 1412 Solvent Content 42.03

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 8
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1twy
    1. Structural context for protein N_glycosylation in bacteria: The structure of PEB3, an adhesin from Campylobacter jejuni
    ES Rangarajan, S Bhatia, DC Watson - Protein , 2007 - Wiley Online Library
     
    2. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch