.
The Open Protein Structure Annotation Network
PDB Keyword
.

1txl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein yodA. To be Published
    Site NYSGXRC
    PDB Id 1txl Target Id NYSGXRC-T1465
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8168,7429457 Molecular Weight 24629.44 Da.
    Residues 215 Isoelectric Point 5.92
    Sequence airlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllq sgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyk sgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlssee vveemmsh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2522
    Matthews' coefficent 1.90 Rfactor 0.2282
    Waters 224 Solvent Content 35.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1txl
    1. A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins
    B Pickel, J Pfannstiel, A Steudle, A Lehmann - FEBS , 2012 - Wiley Online Library
     
    2. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch