.
The Open Protein Structure Annotation Network
PDB Keyword
.

1txn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of coproporphyrinogen III oxidase. To be Published
    Site NYSGXRC
    PDB Id 1txn Target Id NYSGXRC-P035
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8064,P11353 Molecular Weight 37709.71 Da.
    Residues 328 Isoelectric Point 6.32
    Sequence mpapqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdgttfekggv nvsvvygqlspaavsamkadhknlrlpedpktglpvtdgvkffacglsmvihpvnphaptthlnyryfe twnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkhdtalyprfkkwcdeyfyithrketrg iggiffddyderdpqeilkmvedcfdaflpsyltivkrrkdmpytkeeqqwqairrgryvefnliydrg tqfglrtpgsrvesilmslpehaswlynhhpapgsreakllevttkprewvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.245
    Matthews' coefficent 2.00 Rfactor 0.211
    Waters 431 Solvent Content 40.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1txn
    1. Protein production by auto-induction in high-density shaking cultures
    FW Studier - Protein expression and purification, 2005 - Elsevier
     
    2. Evolution of protein fold in the presence of functional constraints
    A Andreeva, AG Murzin - Current opinion in structural biology, 2006 - Elsevier
     
    3. Toward the detection and validation of repeats in protein structure
    KB Murray, WR Taylor - : Structure, Function, and , 2004 - Wiley Online Library
     
    4. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch