.
The Open Protein Structure Annotation Network
PDB Keyword
.

1txz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of ADP-ribose-1''-monophosphatase (Appr-1''-pase), a ubiquitous cellular processing enzyme. Protein Sci. 14 719-726 2005
    Site NYSGXRC
    PDB Id 1txz Target Id NYSGXRC-P089
    Related PDB Ids 1ty8 1njr 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8072,Q04299 Molecular Weight 32065.55 Da.
    Residues 284 Isoelectric Point 7.17
    Sequence mtgslnrhsllngvkkmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmdsmrkgdaihh ghsyaivspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleektiecrd giryiihvptvvapsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiisck smafalrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekdaiellip rriltldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.235
    Matthews' coefficent 1.84 Rfactor 0.2
    Waters 87 Solvent Content 33.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2;APR (ADENOSINE-5-DIPHOSPHORIBOSE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1txz
    1. Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1 _-phosphate dephosphorylation by a conserved domain of nsP3
    KS Saikatendu, JS Joseph, V Subramanian, T Clayton - Structure, 2005 - Elsevier
     
    2. Structure and mechanism of ADP_ribose_1 __monophosphatase (Appr_1 __pase), a ubiquitous cellular processing enzyme
    D Kumaran, S Eswaramoorthy, FW Studier - Protein , 2005 - Wiley Online Library
     
    3. Identification of Macrodomain Proteins as Novel O-Acetyl-ADP-ribose Deacetylases
    D Chen, M Vollmar, MN Rossi, C Phillips - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch