.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ty8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN YMX7. To be Published
    Site NYSGXRC
    PDB Id 1ty8 Target Id NYSGXRC-P089
    Related PDB Ids 1txz 1njr 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8071,Q04299 Molecular Weight 32065.55 Da.
    Residues 284 Isoelectric Point 7.17
    Sequence mtgslnrhsllngvkkmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmdsmrkgdaihh ghsyaivspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleektiecrd giryiihvptvvapsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiisck smafalrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekdaiellip rriltldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.244
    Matthews' coefficent 1.84 Rfactor 0.19
    Waters 166 Solvent Content 33.00

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch