.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Transcriptional Activator tenA from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 1tyh Target Id NYSGXRC-T1491
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8178,16078230 Molecular Weight 28768.57 Da.
    Residues 248 Isoelectric Point 5.51
    Sequence mslkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaayakdlyt tgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcy wlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyye yqfwgmayrkegwsdsaikeveecgasrhngeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.54 Rfree 0.3039
    Matthews' coefficent 2.30 Rfactor 0.2437
    Waters 112 Solvent Content 46.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tyh
    1. Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II
    V Angela, AL Haas, JH Park, TP Begley, SE Ealick - Biochemistry, 2005 - ACS Publications
     
    2. Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathwayevidence of a different substrate specificity
    N Barison, L Cendron, A Trento, A Angelini - FEBS , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch