.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tzz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum. To be Published
    Site NYSGXRC
    PDB Id 1tzz Target Id NYSGXRC-T1523
    Molecular Characteristics
    Source Bradyrhizobium japonicum
    Alias Ids TPS8188,27381841 Molecular Weight 43337.19 Da.
    Residues 392 Isoelectric Point 6.14
    Sequence gshmsvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqgglire rfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagkplfrl laerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavleei gkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpmatgenlfshqda rnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciphgghqmslniaaglglggnes ypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlykemkalae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.86 Rfree 0.2538
    Matthews' coefficent 2.72 Rfactor 0.234
    Waters 303 Solvent Content 53.10

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1tzz
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch