.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of trehalose-6-phosphate phosphatase-related protein: biochemical and biological implications. Protein Sci. 15 1735-1744 2006
    Site NYSGXRC
    PDB Id 1u02 Target Id NYSGXRC-T1731
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS8227,10640520 Molecular Weight 27103.60 Da.
    Residues 239 Isoelectric Point 5.93
    Sequence mslifldydgtlvpiimnpeesyadagllslisdlkerfdtyivtgrspeeisrflpldinmicyhgac skingqivynngsdrflgvfdriyedtrswvsdfpglriyrknlavlyhlglmgadmkpklrsrieeia rifgvetyygkmiielrvpgvnkgsairsvrgerpaiiagddatdeaafeanddaltikvgegethakf hvadyiemrkilkfiemlgvqkkqeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.2161
    Matthews' coefficent 2.70 Rfactor 0.1968
    Waters 173 Solvent Content 45.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 1;NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 1u02
    1. Evolutionary genomics of the HAD superfamily: understanding the structural adaptations and catalytic diversity in a superfamily of phosphoesterases and allied
    AM Burroughs, KN Allen, D Dunaway-Mariano - Journal of molecular , 2006 - Elsevier
     
    2. HAD superfamily phosphotransferase substrate diversification: structure and function analysis of HAD subclass IIB sugar phosphatase BT4131
    Z Lu, D Dunaway-Mariano, KN Allen - Biochemistry, 2005 - ACS Publications
     
    3. Isolation and characterization of drought-related trehalose 6-phosphate-synthase gene from cultivated cotton (Gossypium hirsutum L.)
    SA Kosmas, A Argyrokastritis, MG Loukas, E Eliopoulos - Planta, 2006 - Springer
     
    4. Trehalose and trehalose-based polymers for environmentally benign, biocompatible and bioactive materials
    N Teramoto, ND Sachinvala, M Shibata - Molecules, 2008 - mdpi.com
     
    5. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    6. Structure of Leishmania mexicana Phosphomannomutase Highlights Similarities with Human Isoforms
    L Kedzierski, RL Malby, BJ Smith, MA Perugini - Journal of molecular , 2006 - Elsevier
     
    7. Quantum Chemical Investigations on Intraresidue Carbonyl_ Carbonyl Contacts in Aspartates of High-Resolution Protein Structures
    TK Pal, R Sankararamakrishnan - The Journal of Physical , 2009 - ACS Publications
     
    8. ISN1 nucleotidases and HAD superfamily protein fold: in silico sequence and structure analysis
    B Srinivasan, H Balaram - In silico biology, 2007 - IOS Press
     
    9. Expansive evolution of the TREHALOSE-6-PHOSPHATE PHOSPHATASE gene family in Arabidopsis thaliana
    L Vandesteene, L Lopez-Galvis, K Vanneste - Plant , 2012 - Am Soc Plant Biol
     
    10. A possible degree of motional freedom in bacterial chemoreceptor cytoplasmic domains and its potential role in signal transduction
    W Hu - International journal of biochemistry and molecular , 2011 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch