.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein. To be Published
    Site NYSGXRC
    PDB Id 1u05 Target Id NYSGXRC-T899
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS8151,24113933 Molecular Weight 26378.65 Da.
    Residues 243 Isoelectric Point 6.52
    Sequence msklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlpskpvwleq vhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtevaavhagwrglcagvleet vscfadkpenilawlgpaigprafevgaevreafmavdakasaafiqhgdkyladiyqlarqrlanvgv eqifggdrctytenetffsyrrdkttgrmasfiwli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.283
    Matthews' coefficent 2.30 Rfactor 0.217
    Waters 191 Solvent Content 46.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1u05
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     
    3. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch