.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u6l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein from Pseudomonas aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 1u6l Target Id NYSGXRC-T1794
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8243,15596550 Molecular Weight 16438.71 Da.
    Residues 149 Isoelectric Point 5.58
    Sequence mslqivpylifngncreafscyhqhlggtleamlpfgdspecgdipadwkdkimharlvvgsfalmasd nhpaypyegikgcsislnvdskaeaerlfnalaeggsvqmplgptfwaasfgmftdrfgvawmvnceqd reggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.81 Rfree 0.25712
    Matthews' coefficent 2.78 Rfactor 0.19709
    Waters 243 Solvent Content 55.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u6l
    1. DBAli tools: mining the protein structure space
    MA Marti-Renom, U Pieper - Nucleic acids , 2007 - Oxford Univ Press
     
    2. Atomic resolution structure of EhpR: phenazine resistance in Enterobacter agglomerans Eh1087 follows principles of bleomycin/mitomycin C resistance in
    S Yu, A Vit, S Devenish, HK Mahanty - BMC structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch